Coenzyme nadp. Function of coenzyme f420-dependent nadp reductase in methanogenic .... Purification and characterization of cinnamoyl-coenzyme a:nadp ....

As3d: f420_oxidored, nadp oxidoreductase coenzyme f420-dependent ....

Interpro: ipr002202 hydroxymethylglutaryl-coenzyme a reductase

Coenzyme nadp.

3-hydroxy-3-methylglutaryl-coenzyme a reductase, nadp-dependent ...

VRILGSTEKGAKFLTDAEVISLVNAKHIPAYKLETLMGNSERGVSIRRQMLSQKLPEPL 561IFADLPYRNYNYSLVLELAVKTVIGYMPIPVGVAGPLYLDNKEFQVPMATTEGCLVASTNRGCRAICLGGGARSRILADG 641MTRGPVVRLPSACQAAEVKAWLESPEGFKIVKEAFDSTSRFARLQKLLISLAGRNLYIRFQSKTGDAMGMNMISKGTEKA 721LARLNEEFPDLQVIAISGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVKEVLKTTTEDIVEVNINKNLVGPAMAGSIG 801GYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMERTXVPPDEDLYISCTMPSIEIGTVGGGTNLLPQQACLPDVGGQGA 881SQDNPGENARQLAKIVCATVMAGELSLMAALAAGHLGQKPHDPQTXSKTKFYKIFKEPALRRQLEYYRFEIQQL ESTs ESTs in Contig gi 20215088 gi 20214290 gi 25960981 gi 20262171 gi 20213976 gi 20262716 gi 20209999 gi 25864991 gi 25976023 gi 25741169 gi 20216999 gi 20266011 gi 20212518 gi 20214038 gi 20213959 gi 25961524 gi 32289303 gi 25534650 gi 20211432 gi 20210178 gi 25878517 gi 25862405 gi 25831606 gi 20265094 gi 25728972 gi 25968911 gi 25545113 gi 25322165 gi 25969671 gi 25967030 gi 11370593 gi 25952475 gi 25517079 gi 7131354 gi 6579450 gi 25963872 gi 25949852 gi 25315327 gi 25317049 gi 25826673 gi 25492226 gi 11370659 gi 20215271 gi 25971842 gi 25528209 gi 25541290 gi 25972910 gi 25931062 gi 27591287 gi 14473864 gi 20210264 gi 25489222 gi 33490673 gi 25902089 gi 25367723 gi 25334132 gi 25743823 gi 25961578 gi 25726085 gi 33489863 gi 11370524 gi 25542176 gi 11370521 gi 20215199 gi 25891673 gi 20211699 gi 25482092 gi 25349802 gi 25762753 gi 25493681 gi 25368643 gi 25457992 gi 25962283 gnl UG Gga S17668715 Tissue Types for ESTs Chondrocytes isolated from growth plate cartilage, Bursa of Fabricius, hearts, kidney + adrenal, Gut, limbs, not cerebrum or cerebellum, cerebellum, heads, cerebrum, ovary, liver, head, mus coenzyme nadp

[ Nadh research ]

coenzyme nadp News:

Esenteroides6.9e-613532View alignmentSCOPMMDBCATH1e77 ( Chain: A)Complex of active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides with substratePDB_InfoPDB_StructureLeuconostoc mesenteroides6.9e-613532View alignmentSCOPMMDBCATH1h9b ( Chain: A)Active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroidesPDB_InfoPDB_StructureLeuconostoc mesenteroides6.9e-613532View alignmentSCOPMMDBCATH1h9a ( Chain: A)Complex of active mutant (q365->c) of glucose 6-phosphate dehydrogenase from l. mesenteroides with coenzyme nadpPDB_InfoPDB_StructureLeuconostoc mesenteroides6.9e-613532View alignmentSCOPMMDBCATH1e7y ( Chain: A)Active site mutant (d177->n) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides complexed with substrate and nadphPDB_InfoPDB_StructureLeuconostoc mesenteroides1.1e-603532View alignmentSCOPMMDBCATH1e7m ( Chain: A)Active site mutant (d177->n) of glucose 6-phosphate dehydrogenase from leuconostoc mesen

coenzyme nadp 444905002350 coenzyme nadp.

coenzyme nadp N of the enzyme activities after removal of excess salt has not been tested as the enzymes had a tendency to precipitate upon long exposure to room temperature or even 4 deg C during dialysis.M. tb ICD-1 and M. tb ICD-2 are NADP-dependent and have differential metal cofactors requirementThe coenzyme specificity of M. tb ICD-1 and M. tb ICD-2 was confirmed by checking the activity with both NADP+ and NAD+ (Figure 5a and 5b). The activity curves indicate that M. tb ICDs are NADP+ -- dependent members of the isocitrate dehydrogenase family and shows no activity whatsoever in presence of NAD+.The two enzymes were tested for metal ion requirement with respect to four divalent metal ions coenzyme nadp, namely coenzyme nadp, Mg++ coenzyme nadp, Zn++ and Mn++ and Ca++. It was apparent that M. tb ICD-1 accepts both Mg++and Zn++ as divalent metal ion cofactor but shows no activity in presence of either Mn++ or Ca++ (Figure 6a). This is unlike M. tb ICD-2 coenzyme nadp, which accepts only Mg++ as metal ion and shows no activity with either Zn++ coenzyme nadp, Ca++ .

coenzyme nadp CAGAAACATCCTAGGTGGAACTGTATTTAGAGAACCCATCATTATTCCAAAAAT ACCTCGTCTAGTCCCTCACTGGGAGAAACCTATAATTATAGGCCGTCATGCTTTTGGTGA CCAATATAGGGCTACTGACATCAAGATTAAAAAAGCAGGCAAACTAAGGTTACAGTTTAG CTCAGATGACGGTAAAGAAAACATCGATTTAAAGGTTTATGAATTTCCTAAAAGTGGTGG GATCGCAATGGCAATGTTTAATACAAATGATTCCATTAAAGGGTTCGCAAAGGCATCCTT CGAATTAGCTCTCAAAAGAAAACTACCGTTATTCTTTACAACCAAAAACACTATTCTGAA AAATTATGATAATCAGTTCAAACAAATTTTCGATAATTTGTTCGATAAAGAATATAAGGA AAAGTTTCAGGCTTTAAAAATAACGTACGAGCATCGTTTGATTGATGATATGGTAGCACA GATGCTAAAATCAAAGGGCGGGTTTATAATCGCCATGAAGAATTATGATGGCGATGTCCA GTCTGACATTGTGGCACAAGGATTTGGGTCTCTTGGTTTAATGACGTCCATATTGATTAC ACCTGATGGTAAAACGTTTGAAAGCGAGGCTGCCCATGGTACGGTGACCAGACATTTTAG AAAACATCAAAGAGGCGAAGAAACATCAACAAATTCAATAGCCTCAATATTTGCCTGGAC AAGGGCAATTATACAAAGAGGAAAATTAGACAATACAGATGATGTTATAAAATTTGGAAA CTTACTAGAAAAGGCTACTTTGGACACAGTTCAAGTGGGCGGAAAAATGACCAAGGATTT AGCATTGATGCTTGGAAAGACTAATAGATCATCATATGTAACCACAGAAGAGTTTATTGA TGAAGTTGCCAAGAGGCTTCAAAACATGATGCTCAGCTCCAATGAAGACAAGAAAGGTAT GTGCAAACTATAA Amino acid seque.

coenzyme nadp

coenzyme nadp | | | | | |
coenzyme nadp P: www.w3.org TR xhtml1 DTD xhtml1-transitional.dtd"> (IUCr) G6P and NADP+ binding to human G6PD Figure 4 (a) Final 2 Fo - Fc map for G6PD-NADP+ in the region of the coenzyme NADP+. Electron density corresponding to the protein is in grey, contoured at 1.2. Density for NADP+ is in blue, contoured at 0.9. (b) Potential hydrogen-bond interactions for the coenzyme NADP+ in G6PD-NADP+. (c) Potential hydrogen bonds for the coenzyme NADP+ in LM G6PD-NADP+. Interactions and direct contacts are to both backbone and side chains of surrounding residues. Interactions mediated by water molecules (in green) are also shown. The coenzyme lies in a classic `Rossmann-fold', with residues 38-44 as the binding fingerprint. The G6PD sequence does not contain the extended motif recently identified in other nucleotide-binding proteins (Kleiger & Eisenberg, 2002). © International Union of Crystallography 2005